PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013636419.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 198aa    MW: 21660.1 Da    PI: 9.7764
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013636419.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1275.6e-402685362
          zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    +++l+cprCds+ntkfCyynny+lsqPr+fCk+CrryWtkGGalrnvPvGgg+rkn k+s
  XP_013636419.1 26 QEQLNCPRCDSQNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGALRNVPVGGGTRKNAKRS 85
                    7899****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.9E-332783IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3942983IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-242984IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103167IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MQDPAAYYQS MMAKPQQQQQ PQFPVQEQLN CPRCDSQNTK FCYYNNYNLS QPRHFCKSCR  60
RYWTKGGALR NVPVGGGTRK NAKRSTTSPT SPSNNKKTKN TDPDPNSQSA HKPDTEPTRM  120
LYGFPIGDQD VKGMEMSGGG SFSSLLASNM QLGLGGIVLD GSGWDPGMGL RRSEAGNGRG  180
GGGGNPWTDL AMNRVEKN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893441e-163AC189344.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB042J11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013636419.11e-147PREDICTED: dof zinc finger protein DOF3.1-like
RefseqXP_013672507.11e-147PREDICTED: dof zinc finger protein DOF3.1-like
RefseqXP_013737901.11e-147PREDICTED: dof zinc finger protein DOF3.1-like
SwissprotQ94AR67e-88DOF31_ARATH; Dof zinc finger protein DOF3.1
TrEMBLA0A0D3ABV71e-147A0A0D3ABV7_BRAOL; Uncharacterized protein
STRINGBra023888.1-P2e-97(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21270.19e-68DOF zinc finger protein 2